Copy Link Print Information

PLGF Protein, Rhesus macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PLGF Protein, Rhesus macaque (HEK293, His)
  • PLGF Protein, Rhesus macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The PLGF Protein, a growth factor integral to angiogenesis and endothelial cell growth, exhibits stimulatory effects on both proliferation and migration of these cells. Functioning through its binding to the FLT1/VEGFR-1 receptor, PLGF plays a crucial role in orchestrating angiogenic processes. Additionally, it contributes to tumor growth, emphasizing its involvement in pathological angiogenesis. Structurally, PLGF exists as an antiparallel homodimer, connected by disulfide linkages. Furthermore, it can form heterodimers with VEGFA/VEGF, suggesting a dynamic role in the regulation of vascular growth and function. The multifaceted actions and structural arrangements of PLGF underscore its significance in modulating vascular processes and tumor development.

Verified Bioactivity

Measured in a cell proliferation assay using MDA-MB-231 Human Breast Cancer Cells. The ED50 for this effect is 1.493 μg/mL, corresponding to a specific activity is 669.792 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using MDA-MB-231 Human Breast Cancer Cells. The ED50 this effect is 1.493 μg/mL, corresponding to a specific activity is 669.792 units/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-6*His
  • Accession

    F7HB10 (L19-R170)

  • Gene ID
    701219  [NCBI]
  • Molecular Construction
    • N-term
    • PLGF (L19-R170)
      Accession # F7HB10
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PGF; PlGF-2; Prev. PGFL; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein; PLGF; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein, Isoform CRA_a; Placenta Growth Factor; Placental Growth Factor-Like; S

  • AA Sequence

    LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

  • Predicted Molecular Mass

    19.3 kDa

  • Molecular Weight

    Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using MDA-MB-231 Human Breast Cancer Cells. The ED50 this effect is 1.493 μg/mL, corresponding to a specific activity is 669.792 units/mg.

  • PLGF Protein, Rhesus macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PLGF Protein, Rhesus macaque (HEK293, His)
  • PLGF Protein, Rhesus macaque (HEK293, His) Product Image