2. Protéines recombinantes
  3. Others
  4. PMF1 Protein, Human

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human is the recombinant human-derived PMF1 protein, expressed by E. coli , with tag free.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human is the recombinant human-derived PMF1 protein, expressed by E. coli , with tag free.
Background

PMF1 protein is an integral part of the MIS12 complex, crucial for maintaining normal chromosome alignment and segregation, as well as kinetochore formation during mitosis. Additionally, PMF1 may function as a cotranscription partner of NFE2L2, participating in the regulation of polyamine-induced transcription of SSAT. As a component of the MIS12 complex, PMF1 collaborates with MIS12, DSN1, and NSL1. It exhibits interaction with COPS7A and, notably, binds to the leucine-zipper domain of NFE2L2 via its coiled-coil domain. This interaction with NFE2L2 is essential for the transcriptional regulation of SSAT, emphasizing PMF1's role in coordinating cellular processes related to chromosome dynamics and transcriptional regulation.
Species

Human
Source

E. coli
Tag

Tag Free
Accession

Q6P1K2 (M1-E205)
Gene ID

100527963
Molecular Construction
N-term
PMF1 (M1-E205)
Accession # Q6P1K2
C-term
Protein Length

Full Length
Synonyms
PMF1; Polyamine-modulated factor 1; PMF-1
AA Sequence

MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE

Pureté

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Instruction de manipulation (2659 KB)
Références

PMF1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

PMF1 Protein, Human

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
PMF1 Protein, Human
Cat. No.:
HY-P701854
Quantité:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Country or Region *

Adresse e-mail *

     

Numéro de téléphone *

 

Nom de l'organisation *

Remarques

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.