1. Recombinant Proteins
  2. Viral Proteins Others
  3. Porcine circovirus 2 Capsid protein (sf9, His)

Porcine circovirus 2 Capsid protein (sf9, His)

Cat. No.: HY-P74622
Handling Instructions Technical Support

The porcine circovirus 2 capsid protein autonomously constructs the icosahedral capsid of the viral particle, which is essential for initial attachment to host cell surface proteoglycans.Small size contributes to environmental stability and disinfectant resistance.Porcine circovirus 2 Capsid protein (sf9, His) is the recombinant Virus-derived Porcine circovirus 2 Capsid protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The porcine circovirus 2 capsid protein autonomously constructs the icosahedral capsid of the viral particle, which is essential for initial attachment to host cell surface proteoglycans.Small size contributes to environmental stability and disinfectant resistance.Porcine circovirus 2 Capsid protein (sf9, His) is the recombinant Virus-derived Porcine circovirus 2 Capsid protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The Porcine Circovirus 2 Capsid Protein autonomously assembles to construct the virion's icosahedral capsid with a T=1 symmetry, characterized by a very small size (17 - 22 nm in diameter) that contributes to the virus's environmental stability and resistance to certain disinfectants, including detergents. Crucial for the initial attachment to host cell surface proteoglycans, particularly heparan sulfate moieties and chondroitin sulfate B, the capsid protein facilitates the subsequent internalization of the virus through a clathrin-, caveolae-, and dynamin-independent pathway, mediated by actin and Rho-GTPase. Following attachment, the virus traffics to the nucleus, where the capsid protein binds and transports the viral genome and Rep across the nuclear envelope. It forms homomultimers and assembles in the nucleus, potentially in an immature form, before migrating to the cytoplasm upon achieving maturation as a virion. Additionally, the Capsid Protein interacts with Rep, facilitating the relocation of Rep into the nucleus.

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

O56129 (N42-P233)

Gene ID

/

Molecular Construction
N-term
PCV2 Capsid (N42-P233)
Accession # O56129
His
C-term
Protein Length

Partial

Synonyms
Capsid protein; Cap; ORF2
AA Sequence

NGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Predicted Molecular Mass
23.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Porcine circovirus 2 Capsid protein (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Porcine circovirus 2 Capsid protein (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Porcine circovirus 2 Capsid protein (sf9, His)
Cat. No.:
HY-P74622
Quantity:
MCE Japan Authorized Agent: