1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PPT1 Protein, Human (HEK293, His)

PPT1 Protein, Human (HEK293, His)

Cat. No.: HY-P71230
COA Handling Instructions

PPT1 (palmitoyl protein thioesterase 1) crucially promotes lysosomal degradation by specifically removing thioester-linked fatty acyl groups, especially palmitate, from modified cysteine residues in proteins. Its enzymatic activity is particularly suited to acyl chain lengths of 14 to 18 carbons, facilitating the breakdown of target proteins during lysosomal degradation. PPT1 Protein, Human (HEK293, His) is the recombinant human-derived PPT1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PPT1 Protein, Human (HEK293, His) is 279 a.a., with molecular weight of 34-41 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $110 In-stock
50 μg $330 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPT1 (palmitoyl protein thioesterase 1) crucially promotes lysosomal degradation by specifically removing thioester-linked fatty acyl groups, especially palmitate, from modified cysteine residues in proteins. Its enzymatic activity is particularly suited to acyl chain lengths of 14 to 18 carbons, facilitating the breakdown of target proteins during lysosomal degradation. PPT1 Protein, Human (HEK293, His) is the recombinant human-derived PPT1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PPT1 Protein, Human (HEK293, His) is 279 a.a., with molecular weight of 34-41 kDa.

Background

PPT1, or palmitoyl-protein thioesterase 1, plays a crucial role in lysosomal degradation by efficiently removing thioester-linked fatty acyl groups, particularly palmitate, from modified cysteine residues in proteins or peptides. This enzymatic activity is highly specific, exhibiting a preference for acyl chain lengths ranging from 14 to 18 carbons. The targeted removal of these acyl groups contributes to the breakdown of proteins during lysosomal degradation, emphasizing PPT1's significance in cellular processes related to lipid metabolism and protein turnover.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P50897 (D28-G306)

Gene ID
Molecular Construction
N-term
PPT1 (D28-G306)
Accession # P50897
6*His
C-term
Synonyms
Palmitoyl-protein thioesterase 1; PPT-1; Palmitoyl-protein hydrolase 1; PPT1
AA Sequence

DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG

Molecular Weight

34-41 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PPT1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPT1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71230
Quantity:
MCE Japan Authorized Agent: