PRKACG Protein, Human (Active, sf9)

PRKACG Protein, Human (sf9) is the recombinant human-derived PRKACG, expressed by Sf9 insect cells , with tag Free labeled tag. ,

PKA C gamma is a protein kinase that phosphorylates a large number of substrates in the cytoplasm and the nucleus.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.39 nM, the conversion rate is about 20%.

Human

Sf9 insect cells

Tag Free

P22612 (G2-F351)

5568

Full Length of Mature Protein

GNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

40.5 KDa (~40 KDa)

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50mM Tris-HCl, pH7.5, 200mM NaCl, 20% glycerol, 1mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/sk-mes-1-cell.html  [Content Brief]