Profilin-2 Protein, Human (His)

Profilin-2 Protein, a key player in protein folding, specifically binds to cytosolic chaperonin (c-CPN), facilitating the transfer of target proteins. It also interacts with nascent polypeptide chains, aiding proper folding amid various competing pathways for nonnative proteins. Comprising two PFD-alpha type and four PFD-beta type subunits, the heterohexameric structure of Profilin-2 is integral to the PAQosome complex. Collaborating with various members, including RUVBL1, RUVBL2, RPAP3, PIH1D1, PFDN6, PDRG1, UXT, URI1, ASDURF, POLR2E, and DNAAF10/WDR92, Profilin-2 contributes to the biogenesis of diverse protein complexes. Notably, the phosphorylation-dependent interaction with URI1 exhibits a growth-dependent pattern, highlighting intricate regulatory mechanisms in cellular processes. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli, with N-6*His labeled tag. The total length of Profilin-2 Protein, Human (His) is 140 a.a., with molecular weight of ~16 kDa.

PFDN2, a key player in protein folding, exhibits a specific binding affinity for cytosolic chaperonin (c-CPN), facilitating the transfer of target proteins to this complex. Additionally, PFDN2 interacts with nascent polypeptide chains, promoting their proper folding in an environment where various competing pathways for nonnative proteins exist. The heterohexameric structure of PFDN2 comprises two PFD-alpha type and four PFD-beta type subunits. Moreover, PFDN2 is an integral component of the PAQosome complex, collaborating with other members such as RUVBL1, RUVBL2, RPAP3, PIH1D1, PFDN6, PDRG1, UXT, URI1, ASDURF, POLR2E, and DNAAF10/WDR92 in the biogenesis of diverse protein complexes. Notably, the interaction between PFDN2 and URI1 is phosphorylation-dependent and exhibits a growth-dependent pattern, highlighting the intricate regulatory mechanisms involved in cellular processes.

Human

E. coli

N-6*His

P35080 (M1-F140)

5217  [NCBI]

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 300 mM NaCl, 500 mM arginine, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.