Profilin-2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PFDN2, a key player in protein folding, exhibits a specific binding affinity for cytosolic chaperonin (c-CPN), facilitating the transfer of target proteins to this complex. Additionally, PFDN2 interacts with nascent polypeptide chains, promoting their proper folding in an environment where various competing pathways for nonnative proteins exist. The heterohexameric structure of PFDN2 comprises two PFD-alpha type and four PFD-beta type subunits. Moreover, PFDN2 is an integral component of the PAQosome complex, collaborating with other members such as RUVBL1, RUVBL2, RPAP3, PIH1D1, PFDN6, PDRG1, UXT, URI1, ASDURF, POLR2E, and DNAAF10/WDR92 in the biogenesis of diverse protein complexes. Notably, the interaction between PFDN2 and URI1 is phosphorylation-dependent and exhibits a growth-dependent pattern, highlighting the intricate regulatory mechanisms involved in cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Profilin-2 (M1-F140)
      Accession # AAH18049.1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PFN2; D3S1319E; Profilin 2; Profilin; Profilin II; PFL; Profilin-2

  • AA Sequence

    MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM NaCl, 500 mM arginine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00