1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Sheep (HEK293, His)

Prolactin Protein, Sheep (HEK293, His)

Cat. No.: HY-P70745
COA Handling Instructions

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem[1].

Background

PRL actions are mediated by PRL receptors, which belong to the cytokine class 1 receptor superfamily and exist as short and long isoforms. Both long and short forms of the PRL receptor are expressed in the preoptic area, hypothalamus, and amygdala, among other brain regions of rodents. A great variety of biological effects of PRL have been described in adult animals many of which relate to reproduction. PRL increases the synthesis and turnover of dopamine in the basal hypothalamus, in an arrangement that allows it to feedback to inhibit PRL release[1].

Species

Sheep

Source

HEK293

Tag

C-6*His

Accession

P01240 (T31-C229)

Gene ID

443317  [NCBI]

Molecular Construction
N-term
Prolactin (T31-C229)
Accession # P01240
6*His
C-term
Synonyms
Prolactin; PRL
AA Sequence

TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

Prolactin Protein, Sheep (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Sheep (HEK293, His)
Cat. No.:
HY-P70745
Quantity:
MCE Japan Authorized Agent: