Prolactin Protein, Sheep (HEK293, His)

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem^[1].

PRL actions are mediated by PRL receptors, which belong to the cytokine class 1 receptor superfamily and exist as short and long isoforms. Both long and short forms of the PRL receptor are expressed in the preoptic area, hypothalamus, and amygdala, among other brain regions of rodents. A great variety of biological effects of PRL have been described in adult animals many of which relate to reproduction. PRL increases the synthesis and turnover of dopamine in the basal hypothalamus, in an arrangement that allows it to feedback to inhibit PRL release^[1].

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED₅₀ for this effect is 0.09207-0.2578 ng/mL.

• 
  Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED₅₀ for this effect is 0.2578 ng/mL, corresponding to a specific activity is 3.879×10⁶ units/mg.

Sheep

HEK293

C-6*His

P01240 (T31-C229)

443317  [NCBI]

Full Length of Mature Protein

TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

Approximately 25-30 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Roselli CE, et al. Prolactin expression in the sheep brain. Neuroendocrinology. 2008;87(4):206-215.  [Content Brief]