1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Pituitary hormones
  5. Prolactin Protein, Sheep (HEK293, His)

Prolactin Protein, Sheep (HEK293, His)

Cat. No.: HY-P70745
Handling Instructions

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Prolactin Protein, Sheep (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Sheep

Source

HEK 293

Tag

C-6His

Accession

P01240 (T31-C229)

Gene ID

443317

Synonyms
Prolactin; PRL
AA Sequence

TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

PRL actions are mediated by PRL receptors, which belong to the cytokine class 1 receptor superfamily and exist as short and long isoforms. Both long and short forms of the PRL receptor are expressed in the preoptic area, hypothalamus, and amygdala, among other brain regions of rodents. A great variety of biological effects of PRL have been described in adult animals many of which relate to reproduction. PRL increases the synthesis and turnover of dopamine in the basal hypothalamus, in an arrangement that allows it to feedback to inhibit PRL release[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Sheep (HEK293, His)
Cat. No.:
HY-P70745
Quantity:
MCE Japan Authorized Agent: