Copy Link Print Information

Prolactin Protein, Sheep (HEK293, His)

Customer Review

Based on 1 Customer Validation

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem.

For research use only. We do not sell to patients.
  • Species: Sheep
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Prolactin Protein, Sheep (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Sheep (HEK293, His)
  • Prolactin Protein, Sheep (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem[1].

Background

PRL actions are mediated by PRL receptors, which belong to the cytokine class 1 receptor superfamily and exist as short and long isoforms. Both long and short forms of the PRL receptor are expressed in the preoptic area, hypothalamus, and amygdala, among other brain regions of rodents. A great variety of biological effects of PRL have been described in adult animals many of which relate to reproduction. PRL increases the synthesis and turnover of dopamine in the basal hypothalamus, in an arrangement that allows it to feedback to inhibit PRL release[1].

Verified Bioactivity

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.09207-0.2578 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.2578 ng/mL, corresponding to a specific activity is 3.879×106 units/mg.

Technical Parameters

  • Species Sheep
  • Source HEK293
  • Tag C-6*His
  • Accession

    P01240 (T31-C229)

  • Gene ID
    443317  [NCBI]
  • Molecular Construction
    • N-term
    • Prolactin (T31-C229)
      Accession # P01240
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin

  • AA Sequence

    TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Roselli CE, et al. Prolactin expression in the sheep brain. Neuroendocrinology. 2008;87(4):206-215. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.2578 ng/mL, corresponding to a specific activity is 3.879×106 units/mg.

  • Prolactin Protein, Sheep (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Prolactin Protein, Sheep (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Sheep (HEK293, His)
  • Prolactin Protein, Sheep (HEK293, His) Product Image