Protease 7/OmpT Protein, E.coli (His-SUMO)

Protease 7, or OmpT, displays unique proteolytic capabilities, cleaving diverse substrates like T7 RNA polymerase, ferric enterobactin receptor protein (FEP), and protamine. With specificity for paired basic residues, it selectively targets substrates with such motifs, highlighting its pivotal role in diverse biological processes and protein regulation. Protease 7/OmpT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Protease 7/OmpT protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Protease 7/OmpT Protein, E.coli (His-SUMO) is 297 a.a., with molecular weight of ~49.5 kDa.

Protease 7, also known as OmpT, showcases a distinct proteolytic capacity with the ability to cleave various substrates, including T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine, and several other proteins. This protease exhibits a notable specificity for paired basic residues, emphasizing its role in the selective cleavage of substrates with such structural motifs. The versatility of Protease 7/OmpT in targeting proteins with paired basic residues underscores its significance in diverse biological processes and protein regulation.

E.coli

E. coli

N-His;N-SUMO

P58603 (21S-317F)

913212  [NCBI]

STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

Approximately 49.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.