TEV Protease Protein, Tobacco etch virus (S2256N, C-His)

The TEV protease is critical in aphid transmission and has proteolytic activity that cleaves the Gly-Gly dipeptide at its C terminus. In addition to proteolysis, it interacts with virions and aphid stylets, which is critical for aphid transmission. TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is the recombinant Virus-derived TEV Protease protein, expressed by E. coli , with C-6*His labeled tag.

TEV Protease plays a crucial role in aphid transmission and exhibits proteolytic activity, specifically cleaving a Gly-Gly dipeptide at its own C-terminus. Beyond its proteolytic function, TEV Protease interacts with virions and aphid stylets, contributing to its significance in the aphid transmission process. Additionally, TEV Protease acts as a suppressor of RNA-mediated gene silencing, a plant viral defense mechanism, thus modulating the accumulation of viral RNAs. Its potential RNA-binding activity and helicase function suggest its involvement in replication processes. The multifaceted roles of TEV Protease underscore its importance in various aspects of viral infection and host-pathogen interactions.

Measured by its ability to cleave a fusion protein containing the recognition sequence Glu-Asn-Leu-Tyr-Phe-Gln, with the cleavage point after Gln. TEV Protease cleaves ≥50% of the control substrate.

Virus

E. coli

C-6*His

NP_062908.1 (E2039-Q2279, S2256N)

1502321  [NCBI]

Partial

ESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMNKPEEPFQPVKEATQLMNELVYSQ

approximately 26 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 8% trehalose or PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.