Protein E6, HPV16 (His)

Customer Review

Based on 1 Customer Validation

HPV16 E6 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E6 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E6 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E6, HPV16 (His) is a recombinant HPV E6 protein expressed from E. coli with an N-6*His tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

HPV16 E6 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E6 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E6 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E6, HPV16 (His) is a recombinant HPV E6 protein expressed from E. coli with an N-6*His tag.

Background

HPV16 E6 is a multifunctional nuclear phosphoprotein and a key oncoprotein in HPV16 carcinogenesis. HPV16 E6 belongs to the human papillomavirus early protein family. The C-terminal region of HPV16 E6 contains a conserved Cys-X-X-Cys motif, which can reversibly bind to Zn2+ and stabilize the protein structure. The N-terminus of HPV16 E6 has functional similarities with adenovirus E1A protein, facilitating interaction with cellular tumor suppressors[1][2].
HPV16 E6 binds to the tumor suppressor protein p53 through E6-associated protein (E6AP), promotes its ubiquitination and proteasomal degradation, releases transcription factor E2F, activates the cell cycle and inhibits apoptosis. In addition, HPV16 E6 synergizes with E7 to immortalize primary human keratinocytes and neutralize E5-induced cytotoxicity. HPV16 E6 can also activate AP-1 and NF-κB signaling pathways, downregulate E-cadherin expression, enhance cell migration and invasion by destroying intercellular junctions, and interfere with cytoskeleton rearrangement to promote epithelial-mesenchymal transition. The upstream regulatory factors of HPV16 E6 include viral promoters (such as LCR); downstream targets include p53, E2F, p16 and E-cadherin, which are involved in cell cycle control and adhesion regulation.
HPV16 E6 can be used for the mechanism of action of cervical cancer development. The full-length E7 protein or E7 display vector (such as Lactobacillus casei) induces specific anti-tumor immunity in animal models such as TC-1 mice, inhibits tumor growth and improves survival rate. HPV16 E6 is the main target of HPV-related cancer therapeutic vaccines.

In Vitro

Protein E6, HPV16 (3 μg plasmid; 48 h or 24 h) promotes cell growth, neutralized E5-induced cytotoxicity, reduces cell adhesion to tissue culture plastic and endometrial cells, enhances cell migration and invasion, downregulated E-cadherin expression, and activates AP-1 and NF-κB pathways when co-expressed with E7 in trophoblast and cervical cell lines[2].

Verified Bioactivity

Measured in a cell proliferation assay using A549 cells. The ED50  for this effect is <6.8 ng/mL, corresponding to a specific activity is >1.47×105 units/mg.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Protein E6 (M1-L158)
      Accession # P03126
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Protein E6; E6

  • AA Sequence

    MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 500 mM arginine, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 500 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00