PRPS1 Protein, Human (His-SUMO)
Based on 1 Customer Validation
The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
Phosphoribosylpyrophosphate Synthetase 1 (PRPS1) is an essential enzyme that catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP), a critical precursor in nucleotide biosynthesis. PRPP is a central molecule in the de novo biosynthesis of purine and pyrimidine nucleotides, playing a fundamental role in DNA and RNA synthesis. PRPS1 facilitates the transfer of pyrophosphate from ATP to ribose 5-phosphate, generating PRPP. This enzymatic activity is vital for maintaining cellular nucleotide pools and supporting various cellular processes that rely on nucleotide availability.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P60891-1 (P2-L318)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
PRPS1 (P2-L318)
Accession # P60891-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRPS1; Ribose-Phosphate Diphosphokinase 1; Prev. DFN2; Phosphoribosylpyrophosphate Synthetase Isoform I; PPRibP; Deafness 2, Perceptive, Congenital; PRS-I; Ribose-Phosphate Pyrophosphokinase; CMTX5; Ribose-Phosphate Diphosphokinase; DFNX1; PRS I; Deafness
-
AA Sequence
PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
