PRPS1 Protein, Human (His-SUMO)

The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of PRPS1 Protein, Human (His-SUMO) is 317 a.a., with molecular weight of 50.7 kDa.

Phosphoribosylpyrophosphate Synthetase 1 (PRPS1) is an essential enzyme that catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP), a critical precursor in nucleotide biosynthesis. PRPP is a central molecule in the de novo biosynthesis of purine and pyrimidine nucleotides, playing a fundamental role in DNA and RNA synthesis. PRPS1 facilitates the transfer of pyrophosphate from ATP to ribose 5-phosphate, generating PRPP. This enzymatic activity is vital for maintaining cellular nucleotide pools and supporting various cellular processes that rely on nucleotide availability. The role of PRPS1 in PRPP synthesis underscores its significance in fundamental cellular functions, including the preservation of genetic material and the regulation of cellular proliferation.

Human

E. coli

N-SUMO;N-6*His

P60891 (P2-L318)

5631  [NCBI]

PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

50.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.