PRTFDC1 Protein, Human (His)
Based on 1 Customer Validation
PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.
Background
The PRTFDC1 protein demonstrates minimal phosphoribosyltransferase activity, with detection levels being notably low in vitro. It exhibits binding affinity towards GMP, IMP, and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). However, its role in purine metabolism or salvage is not anticipated. The protein functions as a homodimer, emphasizing its structural configuration in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9NRG1-1 (M1-V225)
-
Molecular Construction
-
N-term
-
His
-
PRTFDC1 (M1-V225)
Accession # Q9NRG1-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRTFDC1; HHGP; Phosphoribosyl Transferase Domain Containing 1; Phosphoribosyltransferase Domain-Containing Protein 1
-
AA Sequence
MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
