PRTFDC1 Protein, Human (His)

PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag. The total length of PRTFDC1 Protein, Human (His) is 225 a.a., with molecular weight of ~19 kDa.

The PRTFDC1 protein demonstrates minimal phosphoribosyltransferase activity, with detection levels being notably low in vitro. It exhibits binding affinity towards GMP, IMP, and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). However, its role in purine metabolism or salvage is not anticipated. The protein functions as a homodimer, emphasizing its structural configuration in cellular processes.

Human

E. coli

N-His

Q9NRG1 (M1-V225)

56952  [NCBI]

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

Approximately 26 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.