PSAP/Prosaposin Protein, Rat (HEK293, His)

PSAP (or Prosaposin) has multiple functions, including ganglioside binding, protein homodimerization, and scaffolding protein binding. It is involved in processes such as GM1 transport, β-galactosidase regulation, and prostate development. PSAP/Prosaposin Protein, Rat (HEK293, His) is the recombinant rat-derived PSAP/Prosaposin protein, expressed by HEK293 , with C-His labeled tag. The total length of PSAP/Prosaposin Protein, Rat (HEK293, His) is 538 a.a., with molecular weight of ~61 KDa.

PSAP, or Prosaposin, is predicted to possess several functions, including ganglioside binding activity, protein homodimerization activity, and scaffold protein binding activity. It is anticipated to be involved in processes such as ganglioside GM1 transport to the membrane, positive regulation of beta-galactosidase activity, and prostate gland development. Predicted to act upstream of or within processes with a negative effect on gene expression, it is also expected to be involved in animal organ development, glycosylceramide metabolic processes, and protein transport. PSAP is predicted to be located in the aggresome, extracellular region, and late endosome, with activity in the extracellular space and lysosome. The human ortholog(s) of this gene have been implicated in conditions such as atypical Gaucher's disease due to saposin C deficiency, combined saposin deficiency, and late-onset Parkinson's disease. PSAP exhibits biased expression in tissues such as the spleen, brain, and nine other tissues, indicating its involvement in diverse physiological processes.

Rat

HEK293

C-His

NP_037145.2 (S17-N554)

25524  [NCBI]

SPVQDPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQRQLESNKIPEVDLARVVAPFMSNIPLLLYPQDRPRSQPQPKANEDVCQDCMKLVTDIQTAVRTNSSFVQGLVDHVKEDCDRLGPGVSDICKNYVDQYSEVAVQMMMHMQPKEICVMVGFCDEVKRVPMRTLVPATEAIKNILPALELTDPYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEVLVTFGPSLLDVLMHEVNPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQPEEPKQSALRAHVPPQKNGGFCEVCKKLVIYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVEVMDPSFVCSKIGVCPSAYKLLLGTEKCVWGPGYWCQNMETAARCNAVDHCKRHVWN

Approximately 55-75 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.