PSME1 Protein, Human (His)
Based on 1 Customer Validation
The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag.
PSME1 Protein plays a pivotal role in immunoproteasome assembly and is crucial for efficient antigen processing. As a component of the PA28 activator complex, PSME1, along with PSME2, actively enhances the production of class I binding peptides by modulating the cleavage pattern of the proteasome. Together, the PSME1 and PSME2 heterodimer forms a hexameric ring structure integral to these immunoproteasome functions. Additionally, PSME1 has the capacity to form homoheptamers, further emphasizing its role in orchestrating immune responses and antigen presentation.
Measured by its ability to activate the h20S Proteasome to cleave the substrate suc-LLVY-AMC. The specific activity is 2773.07 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q06323 (A2-Y249)
-
Molecular Construction
-
N-term
-
6*His
-
PSME1 (A2-Y249)
Accession # Q06323 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PSME1; IGUP I-5111; Proteasome Activator Subunit 1; Epididymis Secretory Sperm Binding Protein Li 129m; PA28alpha; Interferon-Gamma-Inducible Protein 5111; IFI5111; Interferon-Gamma IEF SSP 5111; Activator Of Multicatalytic Protease Subunit 1; 29-KD MCP A
-
AA Sequence
AMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
-
Molecular Weight
Approximately 28-32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of sterile 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
