PSP94/MSMB Protein, Human (His)

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag. The total length of PSP94/MSMB Protein, Human (His) is 94 a.a., with molecular weight of ~14 kDa.

PSP94/MSMB protein forms a homodimer and interacts with PI16, highlighting its role in molecular interactions and potential functional significance within cellular processes.

Measured by its ability to inhibit the proliferation of DU145 cells. The ED₅₀ for this effect is 0.6869 ng/mL, corresponding to a specificactivity is 1.45×106 Unit/mg.

• 
  Measured by its ability to inhibit the proliferation of DU145 cells.The ED₅₀ for this effect is 0.6869 ng/mL, corresponding to a specificactivity is 1.45×10⁶ Unit/mg.

Human

E. coli

C-His

P08118 (S21-I114)

4477  [NCBI]

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Approximately 14 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.