PVALB Protein, Human (His)
PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag.
In muscle tissue, the PVALB protein, commonly known as parvalbumin, is implicated in the process of relaxation following contraction. Its functional role centers on binding two calcium ions, suggesting a crucial involvement in regulating calcium dynamics within muscle cells. This capacity to sequester calcium underscores parvalbumin's significance in fine-tuning the intricate balance between contraction and relaxation, contributing to the overall control of muscle physiology.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P20472 (S2-S110)
-
Molecular Construction
-
N-term
-
PVALB (S2-S110)
Accession # P20472 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PVALB; D22S749; Parvalbumin; Alpha-Parvalbumin; Parvalbumin Alpha; Alpha-PV
-
AA Sequence
SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
