QDPR Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
The QDPR protein plays a crucial role in cellular biopterin metabolism as it catalyzes the conversion of the quinone dihydrobiopterin into tetrahydrobiopterin. This enzymatic process is essential for the regeneration and recycling of tetrahydrobiopterin, a necessary cofactor for various enzymatic reactions, especially those involved in neurotransmitter synthesis and nitric oxide production Enzymatic reaction. QDPR Protein, Human (HEK293, His) is the recombinant human-derived QDPR protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The QDPR protein plays a crucial role in cellular biopterin metabolism as it catalyzes the conversion of the quinone dihydrobiopterin into tetrahydrobiopterin. This enzymatic process is essential for the regeneration and recycling of tetrahydrobiopterin, a necessary cofactor for various enzymatic reactions, especially those involved in neurotransmitter synthesis and nitric oxide production Enzymatic reaction. QDPR Protein, Human (HEK293, His) is the recombinant human-derived QDPR protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Quinoid dihydropteridine reductase (QDPR) is an enzyme that plays a critical role in the metabolism of biopterin compounds. Specifically, QDPR catalyzes the conversion of quinonoid dihydrobiopterin into tetrahydrobiopterin, a crucial cofactor in various biological processes. Tetrahydrobiopterin is involved in the synthesis of neurotransmitters, such as serotonin and dopamine, and serves as a cofactor for enzymes like phenylalanine hydroxylase, which is essential for amino acid metabolism. By facilitating the reduction of quinonoid dihydrobiopterin, QDPR contributes to the recycling and regeneration of tetrahydrobiopterin, ensuring its availability for various cellular processes. It has to highlight QDPR's specific catalytic function in the biopterin pathway, emphasizing its importance in maintaining the balance of biopterin cofactors critical for neurotransmitter synthesis and other essential biochemical reactions.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Mol Neurodegener
In vivo profiling of astrocyte secretome reveals brain-region specific regulatory networks in a mouse model of amyloid pathology. [Abstract]2026 May 23. PMID: 42177534
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P09417 (A2-F244)
-
Molecular Construction
-
N-term
-
QDPR (A2-F244)
Accession # P09417 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
QDPR; PKU2; Quinoid Dihydropteridine Reductase; Short Chain Dehydrogenase/Reductase Family 33C Member 1; SDR33C1; 6,7-Dihydropteridine Reductase; DHPR; Short Chain Dehydrogenase/Reductase Family 33C, Member 1; Dihydropteridine Reductase; Testis Secretory
-
AA Sequence
AAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
-
Predicted Molecular Mass
26.8 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 15% Trehalose, 8% Mannitol, 0.05% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
