RANKL/TNFSF11 Protein, Mouse (HEK293, Fc)

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANKL (R72-D316) with N-terminal hFc tag, which is produced in HEK293^[1][2].

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes^[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells^[2]. In mice, RANKL/RANK signaling attenuates inflammation in ischemic brains through a Toll-like receptor signaling pathway^[4].
RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM^[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)^[1].

RANKL (mouse, 3 ng/mL, 4 days) induces osteoclast differentiation from RAW264.7 cells, and can be inhibited by Resveratrol^[5].
RANKL (mouse,1 ng/mL, -3 h) induces NF-κB activation in murine hepatocyte cell line (AML-12) ^[6].

RANKL (mouse, i.c.v., 5 ng in 2 μL) reduces IL-1β, MCP-1, IL-6 and TNFα expression in WT mice^[4].
RANKL (mouse, i.p., 1-1 μg) protects against hepatic ischemia/reperfusion liver injury in mice^[6].

1.Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse leukemia cells of monocyte macrophage. The ED₅₀ for this effect is 1.137 ng/mL, corresponding to a specific activity is 8.795×10⁵ units/mg.
2.Immobilized mouse Fc-TNFSF11 at 10 μg/mL (100 μl/well) can bind biotinylated human TNFRSF11B-His , The EC₅₀ of biotinylated human TNFRSF11B-His is 0.07-0.17 μg/mL.

Mouse

HEK293

N-hFc

AAC40113.1 (R72-D316)

21943  [NCBI]

RAQMDPNRISEDSTHCFYRILRLHENAGLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Approximately 58.46 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization. ) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ono T, et al. RANKL biology: bone metabolism, the immune system, and beyond. Inflamm Regen. 2020 Feb 7;40:2.  [Content Brief]

  [2]. Li B, et al. Roles of the RANKL-RANK Axis in Immunity-Implications for Pathogenesis and Treatment of Bone Metastasis. Front Immunol. 2022 Mar 21;13:824117.  [Content Brief]

  [3]. Tobeiha M, et al. RANKL/RANK/OPG Pathway: A Mechanism Involved in Exercise-Induced Bone Remodeling. Biomed Res Int. 2020 Feb 19;2020:6910312.  [Content Brief]

  [4]. Shimamura M, et al. OPG/RANKL/RANK axis is a critical inflammatory signaling system in ischemic brain in mice. Proc Natl Acad Sci U S A. 2014 Jun 3;111(22):8191-6.  [Content Brief]

  [5]. He X, et al. Resveratrol prevents RANKL-induced osteoclast differentiation of murine osteoclast progenitor RAW 264.7 cells through inhibition of ROS production. Biochem Biophys Res Commun. 2010 Oct 22;401(3):356-62.  [Content Brief]