Copy Link Print Information

RecR Protein, E.coli (His-SUMO)

Customer Review

Based on 1 Customer Validation

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • RecR Protein, E.coli (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The RecR protein is suggested to potentially play a vital role in DNA repair, particularly in a RecBC-independent recombinational process. It appears to be intricately involved in facilitating DNA repair mechanisms, and it may operate in conjunction with RecF and RecO, highlighting potential collaborative interactions within the cellular machinery dedicated to DNA repair processes. The specific mechanisms and contexts in which RecR operates in the recombinational repair pathway remain subjects of interest, underscoring the need for further investigation to elucidate its precise functions and molecular interactions in maintaining genomic integrity through DNA repair.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession

    P0A7H6 (M1-F201)

  • Gene ID
    66671226  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • RecR (M1-F201)
      Accession # P0A7H6
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Recombination protein RecR; recR; b0472; JW0461

  • AA Sequence

    MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

  • Predicted Molecular Mass

    38 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RecR Protein, E.coli (His-SUMO) Product Image
    1/16
  • RecR Protein, E.coli (His-SUMO) Product Image