REG-3 alpha/REG3A Protein, Rat (HEK293, Fc)

REG-3 α/REG3A protein is a bactericidal C-type lectin lacking an EPN motif that acts as a hormone in response to stimuli such as IL17A and the intestinal microbiome. It is secreted by various cell types and activates the receptor EXTL3, initiating cell-specific signaling pathways. REG-3 alpha/REG3A Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-hFc labeled tag.

REG-3 alpha/REG3A Protein is a bactericidal C-type lectin that lacks the EPN motif, which may explain its inability to bind peptidoglycan. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A and the gut microbiome. REG-3 alpha/REG3A protein is secreted by different cell types and activates its receptor EXTL3, initiating cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and plays a role in regulating keratinocyte proliferation and differentiation following skin injury. It also inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. In the pancreas, REG-3 alpha/REG3A protein is able to permeabilize beta-cell membranes and stimulate their proliferation.

Rat

HEK293

C-hFc

P35231 (E26-Q174)

171162  [NCBI]

Full Length of Mature Protein

EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ

Approximately 44 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.