1. Recombinant Proteins
  2. Others
  3. RGM-C Protein, Cynomolgus (HEK293, His)

RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RGM-C protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RGM-C protein, expressed by HEK293 , with C-His labeled tag.

Background

RGM-C operates as a bone morphogenetic protein (BMP) coreceptor, contributing to the modulation of BMP signaling and playing a crucial role in the regulation of hepcidin (HAMP) expression, thereby influencing iron homeostasis. This protein interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a network of molecular associations that collectively contribute to its role in mediating BMP-related signaling pathways and iron regulation.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5TJX5/XP_005542141.1 (Q36-D401)

Gene ID
Molecular Construction
N-term
RGM-C (Q36-D401)
Accession # A0A2K5TJX5/XP_005542141.1
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Hemojuvelin; Rgmc; DL-M; HFE2; HFE2AMGC23953; HJV; JH; RGMC; RGM-C
AA Sequence

QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPAAFEDGSVNGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERSRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLDKLHLFPSD

Predicted Molecular Mass
40 kDa (mature) & 26 kDa (C-terminus peptide) & 14 kDa (N-terminus peptide)
Molecular Weight

Approximately 50-60 kDa & 30-40 kDa & 20-25 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RGM-C Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RGM-C Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RGM-C Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701035
Quantity:
MCE Japan Authorized Agent: