RISC Protein, Mouse (HEK293, His)

RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag. The total length of RISC Protein, Mouse (HEK293, His) is 424 a.a., with molecular weight of 50-65 kDa.

The RISC protein emerges as a potential player in maintaining vascular wall and kidney homeostasis, suggesting its likely involvement in regulating key processes within these physiological contexts. Although the precise mechanisms and specific functions of RISC in these tissues are yet to be fully elucidated, its association with vascular and renal homeostasis implies a role in modulating cellular functions critical for the balance and integrity of the vascular wall and kidney. The versatile nature of RISC within these contexts suggests its potential impact on diverse pathways, making it a noteworthy subject for further exploration to uncover its role in the intricate dynamics of vascular and renal physiology.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

C-6*His

Q920A5 (I29-E452)

74617  [NCBI]

IDWREPEGKEVWDYVTVRKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTKQE

Approximately 50-65 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.