RISC Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag.
Background
The RISC protein emerges as a potential player in maintaining vascular wall and kidney homeostasis, suggesting its likely involvement in regulating key processes within these physiological contexts. Although the precise mechanisms and specific functions of RISC in these tissues are yet to be fully elucidated, its association with vascular and renal homeostasis implies a role in modulating cellular functions critical for the balance and integrity of the vascular wall and kidney. The versatile nature of RISC within these contexts suggests its potential impact on diverse pathways, making it a noteworthy subject for further exploration to uncover its role in the intricate dynamics of vascular and renal physiology.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q920A5 (I29-E452)
-
Molecular Construction
-
N-term
-
RISC (I29-E452)
Accession # Q920A5 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SCPEP1; Retinoid Inducible Serine Carboxypeptidase; Serine Carboxypeptidase 1; Carboxypeptidase; RISC; HSCP1; Retinoid-Inducible Serine Carboxypeptidase; SCP1; Serine Carboxypeptidase 1 Precursor Protein
-
AA Sequence
IDWREPEGKEVWDYVTVRKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTKQE
-
Molecular Weight
Approximately 50-65 kDa due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
