RIZ1 Protein, Human (GST)

RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (GST) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-GST labeled tag.

RIZ1 protein serves as an S-adenosyl-L-methionine-dependent histone methyltransferase, demonstrating specificity in methylating 'Lys-9' of histone H3. Beyond its histone modification role, RIZ1 may also function as a DNA-binding transcription factor, with an affinity for the macrophage-specific TPA-responsive element (MTE) within the HMOX1 (heme oxygenase 1) gene. In this context, it is implicated as a potential transcriptional activator for HMOX1, suggesting a regulatory role in the expression of this gene.

Human

E. coli

N-GST

Q13029 (M1-A200)

7799  [NCBI]

Partial

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA

Approximately 49.6 kDa,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/jurkat-cell.html  [Content Brief]