RNF5 Protein, Human (Cell-Free, His)
Based on 1 Customer Validation
The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
RNF5 Protein, a membrane-bound E3 ubiquitin-protein ligase, plays a pivotal role in the ubiquitination of target proteins, exhibiting diverse cellular functions. Teaming up with E2 ubiquitin-conjugating enzymes such as UBE2D1/UBCH5A and UBE2D2/UBC4, RNF5 orchestrates ubiquitination processes with a broad substrate range. Notably, it mediates the ubiquitination of PXN/paxillin, influencing cell motility and the cellular localization of PXN/paxillin. Additionally, RNF5 catalyzes the ubiquitination of Salmonella type III secreted protein sopA and JKAMP, modulating their functions. The 'Lys-63'-linked polyubiquitination of JKAMP regulates its association with the proteasome and ERAD components, while the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leads to proteasomal degradation, impacting antiviral responses. Furthermore, RNF5 catalyzes the ubiquitination and subsequent degradation of ATG4B, providing a mechanism to inhibit autophagy. These diverse activities highlight the versatile regulatory role of RNF5 in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q99942 (A2-I180)
-
Gene ID6048
-
Molecular Construction
-
N-term
-
10*His
-
RNF5 (A2-I180)
Accession # Q99942 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
RNF5; Ram1 Homolog; Ring Finger Protein 5; RING-Type E3 Ubiquitin Transferase RNF5; RMA1; E3 Ubiquitin-Protein Ligase RNF; RING5; RING Finger Protein 5; NG2; RING Finger Protein; G16; Protein G16; Ring Finger Protein 5, E3 Ubiquitin Protein Ligase; HsRma1
-
AA Sequence
AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
-
Predicted Molecular Mass
25.8 kDa
-
Molecular Weight
Approximately 27 kDa & 54 kDa & 108 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
