RTBDN Protein, Human (HEK293, His)
The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The RTBDN protein serves as a riboflavin-binding protein, indicating a potential involvement in the transport of retinal flavins. As a carrier for riboflavin, RTBDN may play a crucial role in facilitating the transport of this essential vitamin, contributing to various biological processes and cellular functions. The specific binding and potential transport of riboflavin by RTBDN suggest its importance in supporting retinal health and function through the regulation of flavin molecules.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BSG5 (S31-P229)
-
Molecular Construction
-
N-term
-
RTBDN (S31-P229)
Accession # Q9BSG5 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
RTBDN; CDNA FLJ36353 Fis, Clone THYMU2007307; Retbindin; Retbindin, Isoform CRA_c; FLJ36353
-
AA Sequence
SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP
-
Predicted Molecular Mass
22.3 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
