2. Recombinant Proteins
  3. Others
  4. RTBDN Protein, Human (HEK293, His)

RTBDN Protein, Human (HEK293, His)

Cat. No.: HY-P71268
Handling Instructions

The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RTBDN Protein, Human (HEK293, His) is 199 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RTBDN Protein, Human (HEK293, His) is 199 a.a., with molecular weight of ~30.0 kDa.
Background

The RTBDN protein serves as a riboflavin-binding protein, indicating a potential involvement in the transport of retinal flavins. As a carrier for riboflavin, RTBDN may play a crucial role in facilitating the transport of this essential vitamin, contributing to various biological processes and cellular functions. The specific binding and potential transport of riboflavin by RTBDN suggest its importance in supporting retinal health and function through the regulation of flavin molecules.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

Q9BSG5 (S31-P229)
Gene ID
Molecular Construction
N-term
RTBDN (S31-P229)
Accession # Q9BSG5
6*His
C-term
Synonyms
Retbindin; RTBDN
AA Sequence

SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP

Molecular Weight

Approximately 30.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

RTBDN Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RTBDN Protein, Human (HEK293, His)
Cat. No.:
HY-P71268
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.