RuvB Protein, E.coli (His-SUMO)

Customer Review

Based on 1 Customer Validation

RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR). RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR). RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The RuvB protein, a crucial component of the RuvABC complex, plays a pivotal role in the recombinational repair of DNA damaged by UV radiation or chemicals. Additionally, it contributes significantly to the rescue of stalled DNA replication forks through replication fork reversal (RFR), an essential process for UV light survival. This subunit exhibits weak ATPase activity, preferentially binding to ADP over ATP, and its ATPase function is inhibited by its ADP product. Teaming up with RuvA, RuvB promotes Holliday junction (HJ) branch migration, facilitating the dissociation of junctions in the presence of ATP and Mg(2+). Acting as a molecular pump, the RuvB hexamer pulls DNA into and through the RuvAB complex, allowing for the bypass of UV-induced lesions and physically cross-linked DNA strands. While RuvA provides specificity by binding to cruciform junctions, the RuvB ATPase serves as the motor force for branch migration. The RuvA-RuvB complex exhibits 5'-3' helicase activity in vitro, dependent on ATP and most efficient on short dsDNA hybrids. This intricate interplay between RuvA and RuvB in conjunction with the RuvC component orchestrates the resolution of Holliday junctions and facilitates branch migration, highlighting the multifaceted roles of the RuvB protein in DNA repair and replication processes.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • RuvB (M1-P336)
      Accession # P0A812
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Holliday junction branch migration complex subunit RuvB; EC:3.6.4.-; ruvB; b1860; JW1849

  • AA Sequence

    MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

  • Predicted Molecular Mass

    53.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00