1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RuvB Protein, E.coli (His-SUMO)

RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR). RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR). RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The RuvB protein, a crucial component of the RuvABC complex, plays a pivotal role in the recombinational repair of DNA damaged by UV radiation or chemicals. Additionally, it contributes significantly to the rescue of stalled DNA replication forks through replication fork reversal (RFR), an essential process for UV light survival. This subunit exhibits weak ATPase activity, preferentially binding to ADP over ATP, and its ATPase function is inhibited by its ADP product. Teaming up with RuvA, RuvB promotes Holliday junction (HJ) branch migration, facilitating the dissociation of junctions in the presence of ATP and Mg(2+). Acting as a molecular pump, the RuvB hexamer pulls DNA into and through the RuvAB complex, allowing for the bypass of UV-induced lesions and physically cross-linked DNA strands. While RuvA provides specificity by binding to cruciform junctions, the RuvB ATPase serves as the motor force for branch migration. The RuvA-RuvB complex exhibits 5'-3' helicase activity in vitro, dependent on ATP and most efficient on short dsDNA hybrids. This intricate interplay between RuvA and RuvB in conjunction with the RuvC component orchestrates the resolution of Holliday junctions and facilitates branch migration, highlighting the multifaceted roles of the RuvB protein in DNA repair and replication processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A812 (M1-P336)

Gene ID

946371  [NCBI]

Molecular Construction
N-term
6*His-SUMO
RuvB (M1-P336)
Accession # P0A812
C-term
Protein Length

Full Length

Synonyms
ruvB; b1860; JW1849; Holliday junction ATP-dependent DNA helicase RuvB; EC 3.6.4.12
AA Sequence

MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

Molecular Weight

Approximately 53.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RuvB Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RuvB Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71513
Quantity:
MCE Japan Authorized Agent: