1. Recombinant Proteins
  2. Others
  3. S100A12 Protein, Human

S100A12 Protein, Human

Cat. No.: HY-P71270
COA Handling Instructions

The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free. The total length of S100A12 Protein, Human is 92 a.a., with molecular weight of ~11.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $105 In-stock
50 μg $290 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free. The total length of S100A12 Protein, Human is 92 a.a., with molecular weight of ~11.0 kDa.

Background

S100A12, a calcium-, zinc-, and copper-binding protein, plays a pivotal role in regulating inflammatory processes and immune responses. Its pro-inflammatory functions include the recruitment of leukocytes, promotion of cytokine and chemokine production, and modulation of leukocyte adhesion and migration. Functioning as an alarmin or danger-associated molecular pattern (DAMP) molecule, S100A12 activates innate immune cells by binding to the receptor for advanced glycation end products (AGER). This binding triggers signaling pathways such as MAP-kinase and NF-kappa-B, resulting in the production of pro-inflammatory cytokines and the up-regulation of cell adhesion molecules like ICAM1 and VCAM1. Acting as a chemoattractant, it draws monocytes and mast cells to inflammatory sites, inducing degranulation and activation of mast cells. S100A12 also exhibits inhibitory effects on matrix metalloproteinases (MMP2, MMP3, and MMP9) by chelating Zn(2+) from their active sites. Additionally, it demonstrates filariacidal and filariastatic activities, along with antifungal properties against C.albicans and antibacterial effects against E.coli and P.aeruginosa. S100A12 forms homodimers and homooligomers (tetramers or hexamers) in the presence of calcium, zinc, and copper ions and interacts with AGER and CACYBP in a calcium-dependent manner.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P80511 (M1-E92)

Gene ID
Molecular Construction
N-term
S100A12 (M1-E92)
Accession # P80511
C-term
Synonyms
Protein S100-A12; Calcium-binding protein in amniotic fluid 1; Calgranulin-C; Extracellular newly identified RAGE-binding protein; Migration inhibitory factor-related protein 6; S100 calcium-binding protein A12; Calcitermin; S100A12; CGRP; MRP-6; EN-RAGE
AA Sequence

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Molecular Weight

Approximately 11.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100A12 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A12 Protein, Human
Cat. No.:
HY-P71270
Quantity:
MCE Japan Authorized Agent: