S100A14 Protein, Human (His, solution)
Based on 1 Customer Validation
The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.
The S100A14 protein, a member of the S100 protein family characterized by its EF-hand motif and calcium-binding ability, is encoded by this gene located in a cluster of S100 genes on chromosome 1. Notably, decreased levels of this protein have been observed in cancerous tissue, suggesting its potential role as a tumor suppressor and its association with metastasis (PMID: 19956863, 19351828). Additionally, expression analysis reveals biased expression of S100A14 in the esophagus (RPKM 798.1), skin (RPKM 171.2), and several other tissues, highlighting its potential significance in these contexts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
NP_065723.1 (G2-H104)
-
Gene ID57402
-
Molecular Construction
-
N-term
-
His
-
S100A14 (G2-H104)
Accession # NP_065723.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
S100A14; Protein S100-A14; S100 Calcium Binding Protein A14; S114; S100A15; Breast Cancer Membrane Protein 84; BCMP84; S100 Calcium-Binding Protein A14
-
AA Sequence
GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
-
Predicted Molecular Mass
11.5 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
