S100A14 Protein, Human (His, solution)

The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A14 Protein, Human (His, solution) is 103 a.a., with molecular weight of ~12 kDa.

The S100A14 protein, a member of the S100 protein family characterized by its EF-hand motif and calcium-binding ability, is encoded by this gene located in a cluster of S100 genes on chromosome 1. Notably, decreased levels of this protein have been observed in cancerous tissue, suggesting its potential role as a tumor suppressor and its association with metastasis (PMID: 19956863, 19351828). Additionally, expression analysis reveals biased expression of S100A14 in the esophagus (RPKM 798.1), skin (RPKM 171.2), and several other tissues, highlighting its potential significance in these contexts.

Data is not available.

Human

E. coli

N-His

NP_065723.1 (G2-H104)

57402

GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Approximately 12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.