S100A16 Protein, Human
Based on 1 Customer Validation
S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.
S100A16 is a calcium-binding protein known to bind one calcium ion per monomer. It has been implicated in various cellular processes, particularly in adipocyte differentiation. In vitro studies suggest that S100A16 can promote the differentiation of adipocytes. Notably, overexpression of S100A16 in preadipocytes has been associated with increased proliferation, enhanced adipogenesis, and a reduction in insulin-stimulated glucose uptake. The protein forms homodimers and has been shown to interact with TP53, suggesting a potential role in cellular signaling pathways. These findings underscore the multifaceted nature of S100A16, indicating its involvement in calcium-dependent processes and its impact on cellular differentiation and metabolic regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q96FQ6 (M1-S103)
-
Molecular Construction
-
N-term
-
S100A16 (M1-S103)
Accession # Q96FQ6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A16; Protein S100-F; S100 Calcium Binding Protein A16; MGC17528; S100F; S100 Calcium-Binding Protein A16; DT1P1A7; Aging-Associated Protein 13; Aging-Associated Gene 13 Protein; AAG13; Protein S100-A16
-
AA Sequence
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
-
Predicted Molecular Mass
11.8 kDa
-
Molecular Weight
Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
