S100A2 Protein, Human

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free. The total length of S100A2 Protein, Human is 98 a.a., with molecular weight of ~10.53 kDa.

S100A2 Protein emerges as a potential calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A2 indirectly influences numerous physiological processes. Additionally, it may play a role in suppressing tumor cell growth. Existing as a homodimer, S100A2 interacts with FKBP4, revealing its involvement in diverse molecular associations. Notably, its calcium-dependent interaction with PPP5C, mediated by TPR repeats, modulates PPP5C activity, underscoring S100A2's regulatory impact on cellular processes. Furthermore, its interaction with TPPP inhibits TPPP dimerization, as evidenced in recent studies. The multifaceted functions of S100A2 highlight its potential as a key player in cellular signaling and tumor growth suppression.

Measured  by its ability to chemoattract A549 Human non-small cell lung cancer cells.  The ED₅₀ this effect is 13.09 ng/mL, corresponding to a specific  activity is 7.64×10⁴ U/mg.

Human

E. coli

Tag Free

P29034 (M1-P98)

6273  [NCBI]

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Approximately 10.53 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.