Copy Link Print Information

S100A2 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for S100A2 Protein, Human
  • S100A2 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.

Background

S100A2 Protein emerges as a potential calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A2 indirectly influences numerous physiological processes. Additionally, it may play a role in suppressing tumor cell growth. Existing as a homodimer, S100A2 interacts with FKBP4, revealing its involvement in diverse molecular associations. Notably, its calcium-dependent interaction with PPP5C, mediated by TPR repeats, modulates PPP5C activity, underscoring S100A2's regulatory impact on cellular processes. Furthermore, its interaction with TPPP inhibits TPPP dimerization, as evidenced in recent studies. The multifaceted functions of S100A2 highlight its potential as a key player in cellular signaling and tumor growth suppression.

Verified Bioactivity

Measured  by its ability to chemoattract A549 Human non-small cell lung cancer cells.  The ED50 this effect is 13.09 ng/mL, corresponding to a specific  activity is 7.64×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P29034 (M1-P98)

  • Gene ID
    6273  [NCBI]
  • Molecular Construction
    • N-term
    • S100A2 (M1-P98)
      Accession # P29034
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Protein S100-A2; CAN19; Protein S-100L; S100 calcium-binding protein A2; S100A2; S100L  

  • AA Sequence

    MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for S100A2 Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.
Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • S100A2 Protein, Human Product Image
    1/16
  • Experimental Validation Results for S100A2 Protein, Human
  • S100A2 Protein, Human Product Image