S100A5 Protein, Mouse (His)

S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper. Each subunit can bind two calcium ions or two copper ions along with one zinc ion. Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5. Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes. S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A5 Protein, Mouse (His) is 93 a.a., with molecular weight of ~13 kDa.

The S100A5 Protein exhibits versatile binding properties, interacting with calcium, zinc, and copper. Each subunit has the capability to simultaneously bind either two calcium ions or two copper ions along with one zinc ion. Interestingly, calcium and copper ions compete for the same binding sites, indicating a dynamic interplay in the molecular interactions of S100A5. Structurally, the protein exists as a homodimer, with its dimeric form likely playing a role in mediating its functional activities in cellular processes.

Measured in a cell proliferation assay using T24 cells. The ED₅₀ for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×10⁴ units/mg.

Mouse

E. coli

N-10*His

P63084 (M1-K93)

20199  [NCBI]

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.