S100A5 Protein, Mouse (His)
Based on 1 Customer Validation
S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.
The S100A5 Protein exhibits versatile binding properties, interacting with calcium, zinc, and copper. Each subunit has the capability to simultaneously bind either two calcium ions or two copper ions along with one zinc ion. Interestingly, calcium and copper ions compete for the same binding sites, indicating a dynamic interplay in the molecular interactions of S100A5. Structurally, the protein exists as a homodimer, with its dimeric form likely playing a role in mediating its functional activities in cellular processes.
Measured in a cell proliferation assay using T24 cells. The ED50 for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×104 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His
-
Accession
P63084 (M1-K93)
-
Molecular Construction
-
N-term
-
His
-
S100A5 (M1-K93)
Accession # P63084 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A5; S100 Calcium-Binding Protein A5; Prev. S100D; Protein S-100D; S100 Calcium Binding Protein A5; Protein S100-A5
-
AA Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
