1. Recombinant Proteins
  2. Others
  3. S100A5 Protein, Mouse (His)

S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.

Background

The S100A5 Protein exhibits versatile binding properties, interacting with calcium, zinc, and copper. Each subunit has the capability to simultaneously bind either two calcium ions or two copper ions along with one zinc ion. Interestingly, calcium and copper ions compete for the same binding sites, indicating a dynamic interplay in the molecular interactions of S100A5. Structurally, the protein exists as a homodimer, with its dimeric form likely playing a role in mediating its functional activities in cellular processes.

Biological Activity

Measured in a cell proliferation assay using T24 cells. The ED50 for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×104 units/mg.

  • Measured in a cell proliferation assay using T24 cells. The ED50 for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×104 units/mg.
Species

Mouse

Source

E. coli

Tag

N-10*His

Accession

P63084 (M1-K93)

Gene ID
Molecular Construction
N-term
His
S100A5 (M1-K93)
Accession # P63084
C-term
Protein Length

Full Length

Synonyms
Protein S100-A5; Protein S-100D; S100 calcium-binding protein A5
AA Sequence

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK

분자량

Approximately 13 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

S100A5 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

S100A5 Protein, Mouse (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
S100A5 Protein, Mouse (His)
Cat. No.:
HY-P76018
수량:
MCE Japan Authorized Agent: