S100A6 Protein, Mouse

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free. The total length of S100A6 Protein, Mouse is 89 a.a., with molecular weight of ~10 kDa.

S100A6 protein exhibits calcium ion binding activity and zinc ion binding activity, underscoring its role as a multifunctional regulator. This protein is localized in the collagen-containing extracellular matrix, signifying its involvement in extracellular processes. Its expression is observed in various structures, including the eye, genitourinary system, gut, hemolymphoid system gland, and trophectoderm, indicating its potential roles in diverse physiological functions. The orthologous relationship to human S100A6 emphasizes the evolutionary conservation of this protein across species. Moreover, its biased expression in specific tissues, such as the bladder and colon, highlights its potential significance in the context of tissue-specific functions and regulation.

Mouse

E. coli

Tag Free

NP_035443.1 (M1-K89)

20200  [NCBI]

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.