S100A6 Protein, Mouse
Based on 1 Customer Validation
The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.
S100A6 protein exhibits calcium ion binding activity and zinc ion binding activity, underscoring its role as a multifunctional regulator. This protein is localized in the collagen-containing extracellular matrix, signifying its involvement in extracellular processes. Its expression is observed in various structures, including the eye, genitourinary system, gut, hemolymphoid system gland, and trophectoderm, indicating its potential roles in diverse physiological functions. The orthologous relationship to human S100A6 emphasizes the evolutionary conservation of this protein across species. Moreover, its biased expression in specific tissues, such as the bladder and colon, highlights its potential significance in the context of tissue-specific functions and regulation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
NP_035443.1 (M1-K89)
-
Molecular Construction
-
N-term
-
S100A6 (M1-K89)
Accession # NP_035443.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A6; Protein S100-A6; Prev. CACY; S100 Calcium-Binding Protein A6 (Calcyclin); PRA; S100 Calcium-Binding Protein A6; Calcyclin; S100 Calcium-Binding Protein; CABP; Protein S100; 2A9; S10A6; Prolactin Receptor-Associated Protein; 5B10; Growth Factor-Ind
-
AA Sequence
MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
