SARS-CoV-2 NSP8 Protein (His)

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. In the evolutionary dynamics of the novel COVID-19 pandemic, SARS-CoV-2 early evolved into at least three phylogenetic groups characterized by positive selection of specific residues of the accessory proteins ORF3a and ORF8. The five known human betacoronaviruses all have four major structural proteins (E, M, N, and S) and 16 nonstructural proteins (ORF1ab) co-encoded by ORF1a and ORF1b, which are involved in the pathogenicity of the virus. and infectivity. Three of these genes (E, S, and ORF1ab genes) are characterized by strong positive selection in human betacoronaviruses, affecting codons located in functionally important protein domains. ORF1ab protein plays an important role in inhibiting host translation machinery, viral replication and transcription, and suppressing host immune responses. An electrochemiluminescence (ECL) biosensor based on dual-probe hybridization has been developed, using the detection model of "magnetic capture probe-targeted nucleic acid-Ru(bpy)32+ labeled signal probe" to detect the ORF1ab target gene. detection.

Virus

E. coli

C-6*His

YP_009725304.1 (A1-Q198)

43740578  [NCBI]

Full Length

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Approximately 23.7 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

NA