SARS-CoV-2 NSP8 Protein (His)
The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.
Background
The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. In the evolutionary dynamics of the novel COVID-19 pandemic, SARS-CoV-2 early evolved into at least three phylogenetic groups characterized by positive selection of specific residues of the accessory proteins ORF3a and ORF8. The five known human betacoronaviruses all have four major structural proteins (E, M, N, and S) and 16 nonstructural proteins (ORF1ab) co-encoded by ORF1a and ORF1b, which are involved in the pathogenicity of the virus. and infectivity. Three of these genes (E, S, and ORF1ab genes) are characterized by strong positive selection in human betacoronaviruses, affecting codons located in functionally important protein domains. ORF1ab protein plays an important role in inhibiting host translation machinery, viral replication and transcription, and suppressing host immune responses. An electrochemiluminescence (ECL) biosensor based on dual-probe hybridization has been developed, using the detection model of "magnetic capture probe-targeted nucleic acid-Ru(bpy)32+ labeled signal probe" to detect the ORF1ab target gene. detection.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag C-6*His
-
Accession
YP_009725304.1 (A1-Q198)
-
Gene ID43740578 [NCBI]
-
Molecular Construction
-
N-term
-
SARS-CoV-2 NSP8 (A1-Q198)
Accession # YP_009725304.1 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
r2019-nCoV NSP8, His; SARS-CoV 2 nsp8
-
AA Sequence
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
NA
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)