SARS-COV-2 S1 Protein (670a.a, HEK293, Fc-Avi)

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-COV-2 S1 Protein (670a.a, HEK293, Fc-Avi) is the recombinant Virus-derived SARS-COV-2 S1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

The SARS-CoV-2 S1 Protein plays a crucial role in the early stages of viral infection. Spike protein S1 facilitates the attachment of the virion to the cell membrane by interacting with host receptors, thereby initiating the infection process. This initial binding event is pivotal for the subsequent entry of the virus into the host cell. Concurrently, Spike protein S2', serving as a viral fusion peptide, comes into play after S2 cleavage during virus endocytosis. The unmasking of S2' is a key step in the viral fusion process, enabling the merging of the viral membrane with the endosomal membrane and facilitating the release of the viral genetic material into the host cell cytoplasm. The concerted action of these S1 and S2' functionalities underscores the significance of the SARS-CoV-2 S1 Protein in mediating viral entry and fusion, crucial steps in the viral life cycle.

Virus

HEK293

C-Avi;C-hFc

P0DTC2/QHD43416.1 (Q14-R683)

43740568  [NCBI]

Partial

QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR

Approximately 130-140 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.