1. Recombinant Proteins
  2. Viral Proteins Biotinylated Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S1 Protein
  6. SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi)

SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78108
Handling Instructions Technical Support

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

The SARS-CoV-2 S1 Protein plays a crucial role in the early stages of viral infection. Spike protein S1 facilitates the attachment of the virion to the cell membrane by interacting with host receptors, thereby initiating the infection process. This initial binding event is pivotal for the subsequent entry of the virus into the host cell. Concurrently, Spike protein S2', serving as a viral fusion peptide, comes into play after S2 cleavage during virus endocytosis. The unmasking of S2' is a key step in the viral fusion process, enabling the merging of the viral membrane with the endosomal membrane and facilitating the release of the viral genetic material into the host cell cytoplasm. The concerted action of these S1 and S2' functionalities underscores the significance of the SARS-CoV-2 S1 Protein in mediating viral entry and fusion, crucial steps in the viral life cycle.

Species

Virus

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P0DTC2/QHD43416.1 (Q14-R683)

Gene ID
Molecular Construction
N-term
S1 Protein (Q14-R683)
Accession # P0DTC2/QHD43416.1
hFc-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
S1 protein; Spike protein S1; Spike,S1 protein; S glycoprotein Subunit1
AA Sequence

QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR

Predicted Molecular Mass
102.6 kDa
분자량

Approximately 130-140 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
SARS-CoV-2 S1 Protein (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78108
수량:
MCE Japan Authorized Agent: