SCF Protein, Human (P.pastoris)

SCF Protein, Human (P.pastoris), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.

The recombinant human stem cell factor (rhSCF) protein specifically enhances the viability of human myeloid leukemia cell line TF-1 and the proliferation and maturation of human mast cell line LAD2 cell. Recombinant human SCF (rhSCF) can maintain hematopoietic stem cells and mast cell in culture, and it is widely tested in research into differentiation from embryonic stem cell (ESC)/induced pluripotent stem cell (iPSC)^[1].

The ED₅₀ is <2 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of 5 × 10⁵ units/mg.

Human

P. pastoris

Tag Free

P21583-1 (E26-A189)

4254  [NCBI]

Full Length of Soluble KIT ligand

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Approximately 18.6 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM acetic acid.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Akuta T, et al. Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.  [Content Brief]