1. Recombinant Proteins
  2. Others
  3. SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His)

SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P700824
Handling Instructions Technical Support

SCG3/Secretogranin-3 protein is a member of the granulin family and plays a critical regulatory role in the biogenesis of secretory granules. As a sorting receptor for intragranule proteins such as chromogranin A/CHGA, SCG3 contributes to granule formation dynamics. SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCG3/Secretogranin-3 protein is a member of the granulin family and plays a critical regulatory role in the biogenesis of secretory granules. As a sorting receptor for intragranule proteins such as chromogranin A/CHGA, SCG3 contributes to granule formation dynamics. SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

SCG3/Secretogranin-3 Protein, a member of the granin protein family, serves a crucial role in regulating the biogenesis of secretory granules. Functioning as a sorting receptor for intragranular proteins, including chromogranin A/CHGA, SCG3 contributes to the dynamic process of granule formation. Beyond its involvement in granule biogenesis, SCG3 may also play a role in angiogenesis, where it promotes endothelial proliferation, migration, and tube formation through the MEK/ERK signaling pathway. The protein interacts with chromogranin A (CHGA), highlighting its key association with intragranular proteins. Additionally, SCG3 engages in interactions with secretogranin II/SCG2 and carboxypeptidase E (CPE), further emphasizing its intricate involvement in cellular processes related to granule dynamics and angiogenesis.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

I7G9U8 (F20-L468)

Gene ID

101925820

Molecular Construction
N-term
SCG3 (F20-L468)
Accession # I7G9U8
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Secretogranin-3; Secretogranin III; SCG3; SGIII; UNQ2502/PRO5990
AA Sequence

FPKPGGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPLENKPGQSNYSFVDNLNLLKAITEKEKMEKERQSIRSTPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDLNKPTSRTENQAGKIPEKVTPMAAIQDGLTKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGTLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEAEAIKRIYSSL

Predicted Molecular Mass
52.1 kDa
Molecular Weight

Approximately 58-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCG3/Secretogranin-3 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700824
Quantity:
MCE Japan Authorized Agent: