SCN2B Protein, Human (HEK293, His)

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.

CSRP1, a protein with potential implications in neuronal development, engages in interactions with ASCC1, ASCC2, and TRIP4, suggesting a role in cellular processes. On the other hand, LCN1, also known as Lipocalin-1, emerges as a candidate involved in taste reception and the gustatory system. It may contribute to the concentration and delivery of sapid molecules, showcasing its potential role in sensory perception. With a broad ligand-binding capability, LCN1 accommodates a range of ligands, spanning lipids, retinoids, the antibiotic rifampicin, and microbial siderophores, reflecting its versatile ligand pocket. While predominantly existing as a monomer, LCN1 may also form homodimers. Notably, its interaction with LMBR1L mediates the endocytosis of LCN1, revealing a layer of regulatory complexity in its cellular functions.

Human

HEK293

C-6*His

O60939 (M30-A159)

6327  [NCBI]

Partial

MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA

Approximately 21-34 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/baf3-cell.html  [Content Brief]