SCN2B Protein, Human (HEK293, His)
Based on 1 Customer Validation
SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.
Background
CSRP1, a protein with potential implications in neuronal development, engages in interactions with ASCC1, ASCC2, and TRIP4, suggesting a role in cellular processes. On the other hand, LCN1, also known as Lipocalin-1, emerges as a candidate involved in taste reception and the gustatory system. It may contribute to the concentration and delivery of sapid molecules, showcasing its potential role in sensory perception. With a broad ligand-binding capability, LCN1 accommodates a range of ligands, spanning lipids, retinoids, the antibiotic rifampicin, and microbial siderophores, reflecting its versatile ligand pocket. While predominantly existing as a monomer, LCN1 may also form homodimers. Notably, its interaction with LMBR1L mediates the endocytosis of LCN1, revealing a layer of regulatory complexity in its cellular functions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O60939 (M30-A159)
-
Molecular Construction
-
N-term
-
SCN2B (M30-A159)
Accession # O60939 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SCN2B; Sodium Channel, Voltage-Gated, Type II, Beta Subunit; Sodium Voltage-Gated Channel Beta Subunit 2; Neuronal Voltage-Gated Sodium Channel Beta 2 Subunit; Sodium Channel Regulatory Subunit Beta-2; Sodium Channel, Voltage-Gated, Type II, Beta; Sodium
-
AA Sequence
MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA
-
Molecular Weight
Approximately 24-33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
