SECTM1A Protein, Mouse (HEK293, His)

SECTM1A Protein is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can positively regulate local proliferation of TRMs in the context of acute inflammation. SECTM1A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SECTM1A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SECTM1A Protein, Mouse (HEK293, His) is 138 a.a., with molecular weight of 20-40 kDa.

Secreted and transmembrane 1A (SECTM1A) is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages and improving survival outcomes of septic mice. SECTM1A, as an alternative CD7 ligand, is also able to act as a T cells costimulator to enhance T cell proliferation and IL-2 production, but this effect is dependent on glucocorticoid-induced TNFR (GITR) activation. SECTM1A, as a new GITR ligand, promotes the expansion of Th cells, especially Th2, and increases secretion of Th2 cytokines, thereby stimulating the local proliferation of TRM and improve the survival rate of animals after LPS injection. SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can be used for research on inflammatory diseases^[1][2][3].

Mouse

HEK293

C-6*His

A2ABP9 (Q28­T165)

209588  [NCBI]

QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGT

20-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.