Serum amyloid A-3 protein/Saa3 Protein, Mouse (P.pastoris, His)

Serum amyloid A-3 protein/SAA3 is an important acute-phase reactant that plays a key role in responding to acute physiological challenges.As an important apolipoprotein in high-density lipoprotein (HDL) complexes, SAA3 contributes to the regulation of lipid metabolism, demonstrating its multifaceted role in maintaining homeostasis.Serum amyloid A-3 protein/SAA3 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serum amyloid A-3 protein/SAA3 protein, expressed by P.pastoris , with N-6*His labeled tag.

Serum Amyloid A-3 Protein, also known as Saa3, emerges as a significant acute phase reactant with a pivotal role in the body's response to acute physiological challenges. As a crucial apolipoprotein within the high-density lipoprotein (HDL) complex, Saa3 contributes to the regulation of lipid metabolism, highlighting its multifaceted involvement in maintaining homeostasis. Notably, in vitro studies reveal its antimicrobial activity against Escherichia coli, Streptococcus uberis, and Pseudomonas aeruginosa, suggesting a potential role in the innate immune defense against bacterial pathogens. This dual functionality underscores the diverse and essential contributions of Saa3 in both the acute phase response and antimicrobial defense mechanisms.

Mouse

P. pastoris

N-6*His

P04918 (R20-Y122)

20210  [NCBI]

Partial

RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Approximately 15 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.