Copy Link Print Information

SIAE Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for SIAE Protein, Human (HEK293, His)
  • SIAE Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The SIAE (Sialic Acid Acetylesterase) protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. This enzymatic activity is important for regulating the structural modifications of sialic acids, which are essential components of glycoproteins and glycolipids. SIAE-mediated deacetylation at position 9 influences the overall charge and structure of sialic acids, impacting cellular interactions, immune responses, and signal transduction. Understanding the functions of SIAE provides insights into the dynamic regulation of sialic acid modifications and their implications for various physiological processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9HAT2-1 (I24-K523)

  • Gene ID
    54414  [NCBI]
  • Molecular Construction
    • N-term
    • SIAE (I24-K523)
      Accession # Q9HAT2-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SIAE; MGC87009; Prev. YSG2; Cytosolic Sialic Acid 9-O-Acetylesterase Homolog; CSE-C; Sialic Acid-Specific 9-O-Acetylesterase; LSE; Ysg2 Homolog (Mouse); Sialic Acid-Specific Acetylesterase II; AIS6; Sialate O-Acetylesterase; CSEC; Sialic Acid Acetylestera

  • AA Sequence

    IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

  • Predicted Molecular Mass

    57 kDa

  • Molecular Weight

    Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • SIAE Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for SIAE Protein, Human (HEK293, His)
  • SIAE Protein, Human (HEK293, His) Product Image