SIAE Protein, Human (HEK293, His)

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SIAE Protein, Human (HEK293, His) is 500 a.a., with molecular weight of 64-77 kDa.

The SIAE (Sialic Acid Acetylesterase) protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. This enzymatic activity is important for regulating the structural modifications of sialic acids, which are essential components of glycoproteins and glycolipids. SIAE-mediated deacetylation at position 9 influences the overall charge and structure of sialic acids, impacting cellular interactions, immune responses, and signal transduction. Understanding the functions of SIAE provides insights into the dynamic regulation of sialic acid modifications and their implications for various physiological processes.

Human

HEK293

C-6*His

Q9HAT2 (I24-K523)

54414  [NCBI]

IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

64-77 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.