Copy Link Print Information

Sialidase-1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Sialidase-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Sialidase-1 protein is an enzyme that catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins and glycolipids. Its activity is strictly dependent on its presence within a multienzyme complex. Sialidase-1 exhibits a preference for cleaving alpha 2-3 and alpha 2-6 sialyl linkages, indicating its specificity towards particular types of sialic acid modifications. By removing sialic acid residues, Sialidase-1 plays a crucial role in modulating the structure and function of glycoconjugates, impacting cellular interactions, immune recognition, and various signaling pathways. The enzyme's preference for specific sialyl linkages suggests its involvement in regulating distinct biological processes influenced by sialic acid modifications.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q99519 (E48-L415)

  • Gene ID
    4758  [NCBI]
  • Molecular Construction
    • N-term
    • Sialidase-1 (E48-L415)
      Accession # Q99519
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NEU1; G9 Sialidase; Prev. NEU; Neuraminidase 1 (Lysosomal Sialidase); Sialidase-1; Exo-Alpha-Sialidase; N-Acetyl-Alpha-Neuraminidase 1; Neurominidase; Acetylneuraminyl Hydrolase; Neuraminidase; Lysosomal Sialidase; SIAL1; Sialidase 1 (Lysosomal Sialidase)

  • AA Sequence

    ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

  • Predicted Molecular Mass

    41.3 kDa

  • Molecular Weight

    Approximately 39-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Sialidase-1 Protein, Human (HEK293, His) Product Image
    1/16
  • Sialidase-1 Protein, Human (HEK293, His) Product Image