1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. Siglec
  4. Siglec-15
  5. Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi)

Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi)

Cat. No.: HY-P701036
Handling Instructions Technical Support

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The Siglec-15 Protein plays a crucial role in cellular interactions by selectively binding to sialylated glycoproteins, indicating a specific affinity for molecules with sialic acid residues. Additionally, Siglec-15 engages in molecular associations with TYROBP and HCST, suggesting its involvement in intricate signaling pathways. This ability to interact with key signaling partners underscores Siglec-15's potential significance in mediating immune responses and cellular communication. The specific recognition of sialylated glycoproteins highlights the protein's role in recognizing and responding to cell surface modifications, contributing to the complex network of cellular interactions.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-8*His

Accession

XP_005586866.2 (M60-T322)

Gene ID
Molecular Construction
N-term
Siglec-15 (M60-T322)
Accession # XP_005586866.2
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD33 molecule-like 3; CD33L3; HsT1361; Siglec15; CD33 antigen-like 3; SIGLEC-15
AA Sequence

MESSIRLLACLACVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Predicted Molecular Mass
29.2 kDa
분자량

Approximately 33-43 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Siglec-15 Protein, Cynomolgus (Biotinylated, 263a.a, HEK293, His-Avi)
Cat. No.:
HY-P701036
수량:
MCE Japan Authorized Agent: