Copy Link Print Information

SLAMF9 Protein, Mouse (L224P, HEK293, His)

Customer Review

Based on 1 Customer Validation

SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that lacks the signal transduction motifs found in other family members. Slam9 acts mainly as a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation, function and maintenance of pDCs, and is also involved in the initiation of inflammation and clearance of bacterial infection. SLAMF9 Protein, Mouse (L224P, HEK293, His) is the recombinant mouse-derived SLAMF9 protein, expressed by HEK293 , with C-6*His labeled tag and L224P mutation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SLAMF9 Protein, Mouse (L224P, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that lacks the signal transduction motifs found in other family members. Slam9 acts mainly as a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation, function and maintenance of pDCs, and is also involved in the initiation of inflammation and clearance of bacterial infection. SLAMF9 Protein, Mouse (L224P, HEK293, His) is the recombinant mouse-derived SLAMF9 protein, expressed by HEK293 , with C-6*His labeled tag and L224P mutation.

Background

SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Slam9 is a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation of pDCs, regulating the function and maintenance of pDCs in health and during inflammation. SLAMF9 is also involved in the initiation of inflammation and clearance of bacterial infection [1][2][3].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    BAB26328.1 (F18-L230, L224P)

  • Gene ID
    98365  [NCBI]
  • Molecular Construction
    • N-term
    • SLAMF9 (F18-L230, L224P)
      Accession # BAB26328.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SLAMF9; CD2F10; SLAM Family Member 9; Signaling Lymphocytic Activation Molecule Family Member 2001; CD2F-10; Signaling Lymphocytic Activation Molecule Family Member 9; CD84-H1; Cluster Of Differentiation 2 Antigen Family Member 10; SF2001; Cluster Of Diff

  • AA Sequence

    FSGDDEDPEEVVGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVIMAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPISNISSRRISVGSFCADPGYPEKPSML

  • Predicted Molecular Mass

    24.7 kDa

  • Molecular Weight

    Approximately 30-80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SLAMF9 Protein, Mouse (L224P, HEK293, His) Product Image
    1/16
  • SLAMF9 Protein, Mouse (L224P, HEK293, His) Product Image