SLAMF9 Protein, Mouse (L224P, HEK293, His)

SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that lacks the signal transduction motifs found in other family members. Slam9 acts mainly as a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation, function and maintenance of pDCs, and is also involved in the initiation of inflammation and clearance of bacterial infection. SLAMF9 Protein, Mouse (L224P, HEK293, His) is the recombinant mouse-derived SLAMF9 protein, expressed by HEK293 , with C-6*His labeled tag and L224P mutation.

SLAM family member 9 (Slamf9) is a member of the signaling lymphocytic activation molecule family. Slamf9 is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Slam9 is a plasmacytoid dendritic cell (pDC) receptor and is essential for differentiation of pDCs, regulating the function and maintenance of pDCs in health and during inflammation. SLAMF9 is also involved in the initiation of inflammation and clearance of bacterial infection ^[1][2][3].

Mouse

HEK293

C-6*His

BAB26328.1 (F18-L230, L224P)

98365  [NCBI]

Partial

FSGDDEDPEEVVGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVIMAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPISNISSRRISVGSFCADPGYPEKPSML

Approximately 30-80 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.