SLC25A19 Protein, Human (Cell-Free, His)

SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SLC25A19 Protein, Human (Cell-Free, His) is 320 a.a., with molecular weight of 37.0 kDa.

SLC25A19, a mitochondrial transporter, plays a crucial role in facilitating the uptake of thiamine diphosphate into the mitochondria. The mechanism underlying its antiporter activity remains unclear, as it is yet to be determined whether this activity is influenced by the membrane potential or the proton electrochemical gradient within the mitochondria. Nonetheless, SLC25A19's function as a transporter highlights its significance in mitochondrial processes, particularly in the transport of thiamine diphosphate, a crucial coenzyme involved in various metabolic pathways.

Human

E. coli Cell-free

N-10*His

Q9HC21 (M1-R320)

60386

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

37.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.