SLC25A19 Protein, Human (Cell-Free, His)
SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Background
SLC25A19, a mitochondrial transporter, plays a crucial role in facilitating the uptake of thiamine diphosphate into the mitochondria. The mechanism underlying its antiporter activity remains unclear, as it is yet to be determined whether this activity is influenced by the membrane potential or the proton electrochemical gradient within the mitochondria. Nonetheless, SLC25A19's function as a transporter highlights its significance in mitochondrial processes, particularly in the transport of thiamine diphosphate, a crucial coenzyme involved in various metabolic pathways.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9HC21 (M1-R320)
-
Gene ID60386
-
Molecular Construction
-
N-term
-
10*His
-
SLC25A19 (M1-R320)
Accession # Q9HC21 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Mitochondrial thiamine pyrophosphate carrier; Mitochondrial thiamine pyrophosphate transporter; MTPPT; Mitochondrial uncoupling protein 1; Solute carrier family 25 member 19; SLC25A19; DNC; MUP1
-
AA Sequence
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR
-
Predicted Molecular Mass
37 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
