SLC35A1 Protein, Human (sf9, His, MBP, FLAG)

SLC35A1 is a key player in intracellular transport, acting as a transporter to transport CMP-sialic acid from the cytoplasm to the Golgi apparatus. As an antiporter, it exchanges CMP-sialic acid for CMP, maintaining cellular homeostasis. SLC35A1 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A1 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

SLC35A1, a pivotal protein in intracellular transport processes, acts as a transporter facilitating the translocation of CMP-sialic acid from the cytosol into the Golgi apparatus. Operating as an antiporter, SLC35A1 engages in the exchange of CMP-sialic acid for CMP, showcasing its dynamic role in maintaining cellular homeostasis. While it binds both CMP-sialic acid and free CMP, SLC35A1 exhibits a higher affinity for free CMP (By similarity). Remarkably, this versatile transporter can also exchange CMP-sialic acid for AMP and UMP, broadening its functional repertoire. Additionally, SLC35A1 demonstrates its involvement in cellular processes by mediating the transport of CDP-ribitol (By similarity).

Human

Sf9 insect cells

N-MBP;C-Flag;N-8*His

P78382 (A2-V337)

10559

Partial

AAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.