1. Recombinant Proteins
  2. Others
  3. SLC52A1 Protein, Human (sf9, His, MBP, FLAG)

SLC52A1 Protein, Human (sf9, His, MBP, FLAG)

Cat. No.: HY-P702040
Handling Instructions Technical Support

The SLC52A1 protein acts as a plasma membrane transporter, promoting cellular uptake of vitamin B2/riboflavin that is critical for metabolic responses. Humans rely on external sources to obtain B2, which emphasizes its importance. SLC52A1 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC52A1 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SLC52A1 protein acts as a plasma membrane transporter, promoting cellular uptake of vitamin B2/riboflavin that is critical for metabolic responses. Humans rely on external sources to obtain B2, which emphasizes its importance. SLC52A1 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC52A1 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Background

The SLC52A1 Protein operates as a plasma membrane transporter, facilitating the cellular uptake of the water-soluble vitamin B2/riboflavin, which plays a crucial role in biochemical oxidation-reduction reactions associated with carbohydrate, lipid, and amino acid metabolism. Notably, humans are reliant on external sources for vitamin B2/riboflavin as they lack the ability to synthesize it endogenously, emphasizing the significance of intestinal absorption for obtaining this essential nutrient. In addition to its role in vitamin transport, SLC52A1 may function as a cell receptor for retroviral envelopes, particularly those resembling the porcine endogenous retrovirus (PERV-A), suggesting potential implications in microbial infection. This dual functionality highlights the diverse roles of SLC52A1 in cellular processes, ranging from fundamental metabolic pathways to interactions with retroviral elements.

Species

Human

Source

Sf9 insect cells

Tag

N-MBP;C-Flag;N-8*His

Accession

Q9NWF4 (A2-P448)

Gene ID

55065

Molecular Construction
N-term
8*His-MBP
SLC52A1 (A2-P448)
Accession # Q9NWF4
Flag
C-term
Protein Length

Partial

Synonyms
SLC52A1; Solute carrier family 52; riboflavin transporter; member 1; Porcine endogenous retrovirus A receptor 2; PERV-A receptor 2; huPAR-2; Protein GPR172B; Riboflavin transporter 1; hRFT1
AA Sequence

AAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRQLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SLC52A1 Protein, Human (sf9, His, MBP, FLAG) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SLC52A1 Protein, Human (sf9, His, MBP, FLAG)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLC52A1 Protein, Human (sf9, His, MBP, FLAG)
Cat. No.:
HY-P702040
Quantity:
MCE Japan Authorized Agent: