SLC7A11 Protein, Human (Cell-Free, His)
Based on 1 publication(s) in Google Scholar
The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
SLC7A11 Protein, forming a heterodimer with SLC3A2, operates as an antiporter, facilitating the exchange of extracellular anionic L-cystine for intracellular L-glutamate across the cellular plasma membrane. This sodium-independent, electroneutral transport, with a stoichiometry of 1:1, is propelled by the high intracellular concentration of L-glutamate and the intracellular reduction of L-cystine. The pivotal role of SLC7A11 extends to providing L-cystine for maintaining the redox balance between extracellular L-cystine and L-cysteine, essential for cellular protection against oxidative stress. Additionally, it mediates the import of L-kynurenine, contributing to anti-ferroptotic signaling that is crucial for L-cystine and glutathione homeostasis. Furthermore, SLC7A11 facilitates N-acetyl-L-cysteine uptake into the placenta, leading to the down-regulation of oxidative stress, inflammation, and apoptosis-associated pathways. In vitro, the protein exhibits the ability to transport L-aspartate. Beyond its transport functions, SLC7A11 may play a role in astrocyte and meningeal cell proliferation during development, offering neuroprotection by promoting glutathione synthesis and delivery from non-neuronal cells, such as astrocytes and meningeal cells, to immature neurons. Notably, it controls the direct production of pheomelanin pigment.
Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 antibody, the EC50 is 1.528-12.03 ng/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Free Radic Biol Med
2024 Nov 6:226:13-28. PMID: 39510452
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9UPY5 (M1-L501)
-
Gene ID23657
-
Molecular Construction
-
N-term
-
10*His
-
SLC7A11 (M1-L501)
Accession # Q9UPY5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SLC7A11; Cystine/Glutamate Transporter; Solute Carrier Family 7 Member 11; Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11; XCT; Uncharacterized Protein SLC7A11; Solute Carrier Family 7 (Anionic Amino Acid Transporter Light
-
AA Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
-
Predicted Molecular Mass
58.2 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 25 mM HEPES, 150 mM NaCl, 0.05% Brij-78, 6% Trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)