Somatoliberin/GHRH Protein, Human (HEK293, Fc)

The ghrelin/GHRH protein, also known as GRF (Growth Hormone Releasing Factor), is released by the hypothalamus and plays a key role in growth hormone regulation. It stimulates the pituitary gland to secrete growth hormone, which coordinates body growth and development. Somatoliberin/GHRH Protein, Human (HEK293, Fc) is the recombinant human-derived Somatoliberin/GHRH protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Somatoliberin/GHRH Protein, Human (HEK293, Fc) is 55 a.a., with molecular weight of ~36.0 kDa.

The Somatoliberin/GHRH Protein, also known as GRF (Growth Hormone-Releasing Factor), is released by the hypothalamus, playing a pivotal role in the regulation of growth hormone secretion. Upon release, this protein acts on the adenohypophysis, stimulating the secretion of growth hormone. The intricate communication between the hypothalamus and the adenohypophysis, mediated by Somatoliberin/GHRH, is essential for orchestrating the body's growth and development processes. By initiating the release of growth hormone, this protein contributes to the regulation of key physiological functions, emphasizing its central role in the endocrine control of growth and metabolism.

Human

HEK293

C-hFc

P01286 (P21-L75)

2691  [NCBI]

PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Approximately 36.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.